PDB entry 3orm

View 3orm on RCSB PDB site
Description: Mycobacterium tuberculosis PknB kinase domain D76A mutant
Class: transferase
Keywords: Structural Genomics, TB Structural Genomics Consortium, TBSGC, Kinase domain, Signal transduction, TRANSFERASE
Deposited on 2010-09-07, released 2010-12-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine protein kinase
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: MRA_0016, pknB, PknB (Rv0014c)
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TY84
      • engineered mutation (78)
    Domains in SCOPe 2.03: d3orma_
  • Heterogens: AGS, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ormA (A:)
    gshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfr
    reaqnaaalnhpaivavyatgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraie
    viadacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavi
    gtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpipps
    arheglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltdaertsll
    ssaagnlsgpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ormA (A:)
    ryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqnaaalnhp
    aivavyatgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadacqalnfs
    hqngiihrdvkpanimisatnavkvmdfgiaraiataqylspeqargdsvdarsdvyslg
    cvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenry
    qtaaemradlvrvhngeppeapkvlt