PDB entry 3orl

View 3orl on RCSB PDB site
Description: Mycobacterium tuberculosis PknB kinase domain L33D mutant (crystal form 3)
Class: transferase
Keywords: Structural Genomics, TB Structural Genomics Consortium, TBSGC, Kinase domain, Signal transduction, TRANSFERASE
Deposited on 2010-09-07, released 2010-12-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.214
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine protein kinase
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: MRA_0016, pknB, PknB (Rv0014c)
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TY84
      • engineered mutation (35)
    Domains in SCOPe 2.03: d3orla_
  • Heterogens: AGS, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3orlA (A:)
    gshmttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfr
    reaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraie
    viadacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavi
    gtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpipps
    arheglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltdaertsll
    ssaagnlsgpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orlA (A:)
    tpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgitaqylspeqargdsvdarsdvys
    lgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpen
    ryqtaaemradlvrvhngeppeapkvlt