PDB entry 3orc

View 3orc on RCSB PDB site
Description: crystal structure of an engineered cro monomer bound nonspecifically to DNA
Class: gene regulation/DNA
Keywords: cro, protein-DNA interaction, bacteriophage lambda, repressor, monomer-dimer, helix-turn-helix, complex (gene regulating protein-DNA), gene regulation-DNA complex
Deposited on 1998-04-23, released 1998-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cro repressor)
  Species: Enterobacteria phage lambda [TaxId:10710]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03040 (0-64)
    • see remark 999 (55-64)
  Domains in SCOPe 2.08: d3orca_
• Chain 'R':
  Compound: DNA (5'-d(*tp*ap*tp*cp*gp*ap*tp*a)-3')
  
• Chain 'S':
  Compound: DNA (5'-d(*tp*ap*tp*cp*gp*ap*tp*a)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3orcA (A:)
  eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgevk
  pfpsn
  

  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.