PDB entry 3oq7

View 3oq7 on RCSB PDB site
Description: Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
Class: hydrolase
Keywords: Protease, HYDROLASE
Deposited on 2010-09-02, released 2011-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.196
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human Immunodeficiency Virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (34-35)
    • conflict (45)
  Domains in SCOPe 2.08: d3oq7a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oq7A (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf