PDB entry 3op2

View 3op2 on RCSB PDB site
Description: Crystal structure of putative mandelate racemase from Bordetella bronchiseptica RB50 complexed with 2-oxoglutarate/phosphate
Class: isomerase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, racemase, 2-oxoglutarate, PSI-2, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2010-08-31, released 2010-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3op2a1, d3op2a2, d3op2a3
  • Chain 'B':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3op2b1, d3op2b2, d3op2b3
  • Heterogens: MG, AKG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3op2A (A:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op2A (A:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrsvgiaamsgvdialwdlkgramnqpi
    yqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlr
    amrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgt
    pvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtf
    ndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeid
    wdfvaahawkgepai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3op2B (B:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op2B (B:)
    slkitevkahalstpipermrvklnrqmilvevrtdegvtgvgspsgpydlavlkraied
    vigpqligedpaninylwhkvfhgevsrsvgiaamsgvdialwdlkgramnqpiyqllgg
    kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv
    gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat
    genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv
    aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa
    hawkgepa