PDB entry 3op1

View 3op1 on RCSB PDB site
Description: Crystal Structure of Macrolide-efflux Protein SP_1110 from Streptococcus pneumoniae
Class: transferase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, alpha-beta-alpha sandwich, beta barrel, kinase, cytosol, TRANSFERASE
Deposited on 2010-08-31, released 2010-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrolide-efflux protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_1110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3op1a1, d3op1a2
  • Chain 'B':
    Compound: Macrolide-efflux protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_1110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3op1b1, d3op1b2
  • Chain 'C':
    Compound: Macrolide-efflux protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: SP_1110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3op1c1, d3op1c2
  • Heterogens: SO4, GOL, PEG, ACY, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3op1A (A:)
    snamiitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfn
    espkialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyika
    mnakiivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvk
    eagkllgaplpsrgmvvhgnargrtigyptanlvlldrtympadgvyvvdveiqrqkyra
    masvgknvtfdgeearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkad
    eevtrnws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op1A (A:)
    miitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfnesp
    kialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyikamna
    kiivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvkeag
    kllgaplpsrgmvvhgngyptanlvlldrtympadgvyvvdveiqrqkyramasvgknvt
    fdearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkadeevtrnws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3op1B (B:)
    snamiitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfn
    espkialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyika
    mnakiivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvk
    eagkllgaplpsrgmvvhgnargrtigyptanlvlldrtympadgvyvvdveiqrqkyra
    masvgknvtfdgeearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkad
    eevtrnws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op1B (B:)
    iitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfnespk
    ialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyikamnak
    iivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvkeagk
    llgaplpsrgmvvhgnargrtigyptanlvlldrtympadgvyvvdveiqrqkyramasv
    gknvtfdgeearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkadeevt
    rnws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3op1C (C:)
    snamiitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfn
    espkialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyika
    mnakiivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvk
    eagkllgaplpsrgmvvhgnargrtigyptanlvlldrtympadgvyvvdveiqrqkyra
    masvgknvtfdgeearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkad
    eevtrnws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3op1C (C:)
    miitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfnesp
    kialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyikamna
    kiivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvkeag
    kllgaplpsrgmvvhgptanlvlldrtympadgvyvvdveiqrqkyramasvgarfevni
    fdfnqdiygetvmvywldri