PDB entry 3omu

View 3omu on RCSB PDB site
Description: Crystal Structure of the N-terminal domain of an HSP90 from Trypanosoma Brucei, Tb10.26.1080 in the presence of a thienopyrimidine derivative
Class: chaperone
Keywords: hsp90, Trypanosoma bruceii, structural genomics, drug discovery, Structural Genomics Consortium, SGC, chaperone
Deposited on 2010-08-27, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein 83
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.26.1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q389P1 (18-End)
      • expression tag (17)
    Domains in SCOPe 2.07: d3omua1, d3omua2
  • Chain 'B':
    Compound: Heat shock protein 83
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.26.1080
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3omub_
  • Heterogens: IBD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3omuA (A:)
    mhhhhhhssgrenlyfqgmtetfafqaeinqlmsliintfysnkeiflrelisnssdacd
    kiryqsltnqsvlgdephlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtks
    fmealeaggdmsmigqfgvgfysaylvadrvtvvsknneddaytwessaggtftvtstpd
    cdlkrgtrivlhlkedqqeyleerrlkdlikkhsefigydielmventtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omuA (A:)
    gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
    hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
    gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
    qeyleerrlkdlikkhsefigydielmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3omuB (B:)
    mhhhhhhssgrenlyfqgmtetfafqaeinqlmsliintfysnkeiflrelisnssdacd
    kiryqsltnqsvlgdephlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtks
    fmealeaggdmsmigqfgvgfysaylvadrvtvvsknneddaytwessaggtftvtstpd
    cdlkrgtrivlhlkedqqeyleerrlkdlikkhsefigydielmventtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3omuB (B:)
    mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdhlr
    irvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfgvg
    fysaylvadrvtvvsknneddaytwesgtftvtstpdcdlkrgtrivlhlkedqqeylee
    rrlkdlikkhsigydielm