PDB entry 3om9

View 3om9 on RCSB PDB site
Description: T. Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
Class: oxidoreductase
Keywords: Glycolysis, Oxidoreductase, NAD
Deposited on 2010-08-26, released 2010-10-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Lactate Dehydrogenase, TGGT1_115280
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613 (0-326)
      • expression tag (327-328)
    Domains in SCOPe 2.03: d3om9a1, d3om9a2
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Lactate Dehydrogenase, TGGT1_115280
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613 (0-326)
      • expression tag (327-328)
    Domains in SCOPe 2.03: d3om9b1, d3om9b2
  • Chain 'C':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Lactate Dehydrogenase, TGGT1_115280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3om9c1, d3om9c2
  • Chain 'D':
    Compound: lactate dehydrogenase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: Lactate Dehydrogenase, TGGT1_115280
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, OXQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3om9A (A:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqapg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3om9B (B:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqapg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3om9C (C:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om9C (C:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq
    

  • Chain 'D':
    No sequence available.