PDB entry 3om3

View 3om3 on RCSB PDB site
Description: Catalytic core subunits (I and II) of cytochrome C oxidase from Rhodobacter sphaeroides with K362M mutation in the reduced state
Class: oxidoreductase
Keywords: transmembrane protein complex, oxidoreductase
Deposited on 2010-08-26, released 2011-02-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase, aa3 type, subunit I
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: coxI, CTAD, RHOS4_04590, RSP_1877
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3J5A7 (0-534)
      • engineered mutation (345)
    Domains in SCOPe 2.04: d3om3a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: coxII, CTAB, CTAC, RHOS4_04060, RSP_1826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3J5G0 (0-251)
      • expression tag (252-255)
    Domains in SCOPe 2.04: d3om3b1, d3om3b2
  • Chain 'C':
    Compound: Cytochrome c oxidase, aa3 type, subunit I
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: coxI, CTAD, RHOS4_04590, RSP_1877
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3J5A7
      • engineered mutation (345)
    Domains in SCOPe 2.04: d3om3c_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides 2.4.1 [TaxId:272943]
    Gene: coxII, CTAB, CTAC, RHOS4_04060, RSP_1826
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3J5G0 (0-251)
      • expression tag (252-255)
    Domains in SCOPe 2.04: d3om3d1, d3om3d2
  • Heterogens: DMU, TRD, HEA, CU1, MG, CA, HTH, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3om3A (A:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3om3B (B:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3om3C (C:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3om3C (C:)
    wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
    lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
    nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
    ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
    gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
    mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsielkt
    pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
    igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
    gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3om3D (D:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh