PDB entry 3okd

View 3okd on RCSB PDB site
Description: Crystal structure of S25-39 in complex with Kdo
Class: immune system
Keywords: antibody, Fab, IgG, carbohydrate, IMMUNE SYSTEM
Deposited on 2010-08-24, released 2011-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.235
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S25-39 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OKD (0-218)
    Domains in SCOPe 2.06: d3okda1, d3okda2
  • Chain 'B':
    Compound: S25-39 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OKD (0-End)
  • Heterogens: PEG, KDO, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3okdA (A:)
    divmtqspsslavsagekvtmnckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdfaltissvqaedlavyyckqsynlrtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserangvlnswtdqdskdstysm
    tstltltkdeyerhnsytceashktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.