PDB entry 3ok5

View 3ok5 on RCSB PDB site
Description: Structure of the H55D mutant of dehaloperoxidase-hemoglobin A from Amphitriti ornata with 4-Bromophenol inhibitor
Class: oxidoreductase
Keywords: globin, peroxidase, dehaloperoxidase, OXIDOREDUCTASE
Deposited on 2010-08-24, released 2011-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.244
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dehaloperoxidase A
  Species: Amphitrite ornata [TaxId:129555]
  Gene: dhpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NAV8 (0-136)
    • engineered mutation (54)
  Domains in SCOPe 2.06: d3ok5a_
• Chain 'B':
  Compound: Dehaloperoxidase A
  Species: Amphitrite ornata [TaxId:129555]
  Gene: dhpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NAV8 (0-136)
    • engineered mutation (54)
  Domains in SCOPe 2.06: d3ok5b_
• Heterogens: HEM, BML, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ok5A (A:)
  gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
  nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
  drfgknlvsalssagmk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ok5B (B:)
  gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
  nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
  drfgknlvsalssagmk