PDB entry 3ok0

View 3ok0 on RCSB PDB site
Description: E35A Mutant of Hen Egg White Lysozyme (HEWL)
Class: hydrolase
Keywords: o-glycosyl, hydrolase
Deposited on 2010-08-24, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Gallus gallus [TaxId:9031]
  Gene: LYZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • engineered mutation (34)
  Domains in SCOPe 2.07: d3ok0a_
• Heterogens: NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ok0A (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfasnfntqatnrntdgstdygilqins
  rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
  qawirgcrl