PDB entry 3ojp

View 3ojp on RCSB PDB site
Description: D52N Mutant of Hen Egg White Lysozyme (HEWL)
Class: hydrolase
Keywords: o-glycosyl, hydrolase
Deposited on 2010-08-23, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d3ojpa_
  • Heterogens: ACT, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ojpA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstnygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl