PDB entry 3oj5

View 3oj5 on RCSB PDB site
Description: Mycobacterium tuberculosis ferritin homolog, BfrB
Class: oxidoreductase
Keywords: ferroxidase, cytosol, OXIDOREDUCTASE
Deposited on 2010-08-20, released 2011-09-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5a_
  • Chain 'B':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5b_
  • Chain 'C':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5c_
  • Chain 'D':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5d_
  • Chain 'E':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5e_
  • Chain 'F':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5f_
  • Chain 'G':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5g_
  • Chain 'H':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5h_
  • Chain 'I':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5i_
  • Chain 'J':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5j_
  • Chain 'K':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5k_
  • Chain 'L':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5l_
  • Chain 'M':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5m_
  • Chain 'N':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5n_
  • Chain 'O':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5o_
  • Chain 'P':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5p_
  • Chain 'Q':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5q_
  • Chain 'R':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5r_
  • Chain 'S':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5s_
  • Chain 'T':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5t_
  • Chain 'U':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5u_
  • Chain 'V':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5v_
  • Chain 'W':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5w_
  • Chain 'X':
    Compound: Ferritin family protein
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: bfrB, MRA_3881, Rv3841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3oj5x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oj5A (A:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5A (A:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oj5B (B:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5B (B:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oj5C (C:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5C (C:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oj5D (D:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5D (D:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3oj5E (E:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5E (E:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3oj5F (F:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5F (F:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3oj5G (G:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5G (G:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3oj5H (H:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5H (H:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3oj5I (I:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5I (I:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3oj5J (J:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5J (J:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3oj5K (K:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5K (K:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3oj5L (L:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5L (L:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3oj5M (M:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5M (M:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3oj5N (N:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5N (N:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3oj5O (O:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5O (O:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3oj5P (P:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5P (P:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3oj5Q (Q:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5Q (Q:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3oj5R (R:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5R (R:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3oj5S (S:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5S (S:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3oj5T (T:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5T (T:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3oj5U (U:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5U (U:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3oj5V (V:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5V (V:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3oj5W (W:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5W (W:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3oj5X (X:)
    mteyegpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernham
    mlvqhlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdfl
    geqfmqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggr
    lgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oj5X (X:)
    ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
    drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
    flqeqieevalmatlvrvadraganlfelenfvarev