PDB entry 3oiw

View 3oiw on RCSB PDB site
Description: H-RasG12V with allosteric switch in the "on" state
Class: signaling protein
Keywords: oncogene GTP-binding nucleotide-binding, signaling protein
Deposited on 2010-08-20, released 2010-12-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.197
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered mutation (11)
  Domains in SCOPe 2.03: d3oiwa_
• Heterogens: GNP, CA, MG, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oiwA (A:)
  mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh