PDB entry 3oiv

View 3oiv on RCSB PDB site
Description: H-RasG12V with allosteric switch in the "off" state
Class: signaling protein
Keywords: oncogene GTP-binding nucleotide-binding, signaling protein
Deposited on 2010-08-20, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (11)
    Domains in SCOPe 2.08: d3oiva_
  • Heterogens: GNP, CA, MG, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3oivA (A:)
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

    Sequence, based on observed residues (ATOM records): (download) 
    >3oivA (A:)
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
mrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartve
srqaqdlarsygipyietsaktrqgvedafytlvreirqh