PDB entry 3oiu

View 3oiu on RCSB PDB site
Description: H-RasQ61L with allosteric switch in the "on" state
Class: signaling protein
Keywords: oncogene GTP-binding nucleotide-binding, signaling protein
Deposited on 2010-08-20, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (60)
    Domains in SCOPe 2.08: d3oiua_
  • Heterogens: GNP, CA, MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oiuA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    leeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh