PDB entry 3oih

View 3oih on RCSB PDB site
Description: Crystal Structure of the complex of xylanase-alpha-amylase inhibitor Protein (XAIP-I) with trehalose at 1.87 A resolution
Class: hydrolase inhibitor
Keywords: TIM barrel, Trehalose, HYDROLASE INHIBITOR
Deposited on 2010-08-19, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haementhin
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oiha_
  • Heterogens: TRE, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oihA (A:)
anldiavywgqnfdersleatcdtgnyayviigflntfgggqtpaldisghspsglepqi
khcqsknvkvllsiggpkgpysldsrsdandlavylfnnfllppghsenrpfgnavldgi
dfhiehggpsqyqllanilssfrlagtefaltaapqcvypdpnlgtvinsatfdaiwvqf
ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppekvkfhvfpa
akksykfggimlwdsywdtvsnfsskilgegw