PDB entry 3ohv

View 3ohv on RCSB PDB site
Description: Crystal structure of the human Bach2 POZ domain, form II
Class: transcription
Keywords: BTB/POZ domain, transcription
Deposited on 2010-08-18, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription regulator protein BACH2
    Species: Homo sapiens [TaxId:9606]
    Gene: Bach2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BYV9 (4-124)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3ohva1, d3ohva2
  • Chain 'B':
    Compound: Transcription regulator protein BACH2
    Species: Homo sapiens [TaxId:9606]
    Gene: Bach2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ohvb_
  • Chain 'C':
    Compound: Transcription regulator protein BACH2
    Species: Homo sapiens [TaxId:9606]
    Gene: Bach2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ohvc_
  • Chain 'D':
    Compound: Transcription regulator protein BACH2
    Species: Homo sapiens [TaxId:9606]
    Gene: Bach2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ohvd_
  • Chain 'E':
    Compound: Transcription regulator protein BACH2
    Species: Homo sapiens [TaxId:9606]
    Gene: Bach2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ohve_
  • Chain 'F':
    Compound: Transcription regulator protein BACH2
    Species: Homo sapiens [TaxId:9606]
    Gene: Bach2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ohvf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ohvA (A:)
    gplgspmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwq
    alvgqtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnleds
    cfsfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ohvB (B:)
    gplgspmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwq
    alvgqtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnleds
    cfsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ohvB (B:)
    spmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvg
    qtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsf
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ohvC (C:)
    gplgspmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwq
    alvgqtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnleds
    cfsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ohvC (C:)
    myvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgqt
    kndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ohvD (D:)
    gplgspmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwq
    alvgqtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnleds
    cfsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ohvD (D:)
    pmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgq
    tkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ohvE (E:)
    gplgspmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwq
    alvgqtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnleds
    cfsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ohvE (E:)
    myvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgqt
    kndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ohvF (F:)
    gplgspmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwq
    alvgqtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnleds
    cfsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ohvF (F:)
    spmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvg
    qtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfs