PDB entry 3ogr

View 3ogr on RCSB PDB site
Description: Complex structure of beta-galactosidase from Trichoderma reesei with galactose
Class: hydrolase
Keywords: TIM barrel domain, Glycoside hydrolase, Family 35, Glycoprotein, hydrolase
Deposited on 2010-08-17, released 2011-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.13
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ogrA (A:)
    tsiglhggrprdiilddakgplqnivtwdehslfvhgervvifsgevhpfrlpvpslyld
    vfhkikalgfntvsfyvdwallegkpgrfradgifslepffeaatkagiyllarpgpyin
    aevsgggfpgwlqrvkgklrtdapdylhatdnyvahiasiiakaqitnggpvilyqpene
    ysgaaegvlfpnkpymqyvidqarnagiivplinndafpggtgapgtglgsvdiyghdgy
    plgfdcahpsawpdnglpttwrqdhlnispstpfslvefqggafdpfggwgfeqcsalvn
    hefervfyknnmaagvtifniymtfggtnwgnlghpggytsydygasiredrridrekys
    elklqgqflkvspgyitatpenatqgvysdsqnivitpllakesgdffvvrhanysstdt
    asytvklptsagdltipqlggsltltgrdskihvtdypvgkftllystaeiftwnefaek
    tvlvlyggaqelhefavknpfgssktakakkiegsnvtihttsnltvvlqwtassarqvv
    qlgslviymvdrnsaynywvptlpgsgkqsaygsslmnpdsviinggylirsvaikgnal
    svqadfnvttpleiigipkgisklavngkelgysvselgdwiahpaieiphvqvpeltkl
    kwykvdslpeirsnyddsrwplanlrtsnntyaplktpvslygsdygfhagtllfrgrft
    artarqqlflstqggsafassvwlndrfigsftgfdaasaanssytldrlvrgrryiltv
    vvdstgldenwttgddsmkaprgildyaltsssganvsiswkltgnlggedyrdvfrgpl
    negglfferqgfhlpspplsdfthgpsssssssspldgiahagiafyaaklplhlpaqey
    diplsfvfdnataaapyrallyvngfqygkyvsnigpqtefpvpegildyngdnwigval
    walesrgakvpglalkskspiltgrervevvkgphfkkrhgay
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ogrA (A:)
    akgplqnivtwdehslfvhgervvifsgevhpfrlpvpslyldvfhkikalgfntvsfyv
    dwallegkpgrfradgifslepffeaatkagiyllarpgpyinaevsgggfpgwlqrvkg
    klrtdapdylhatdnyvahiasiiakaqitnggpvilyqpeneysgaaegvlfpnkpymq
    yvidqarnagiivplinndafpggtgapgtglgsvdiyghdgyplgfdcahpsawpdngl
    pttwrqdhlnispstpfslvefqggafdpfggwgfeqcsalvnhefervfyknnmaagvt
    ifniymtfggtnwgnlghpggytsydygasiredrridrekyselklqgqflkvspgyit
    atpenatqgvysdsqnivitpllakesgdffvvrhanysstdtasytvklptsagdltip
    qlggsltltgrdskihvtdypvgkftllystaeiftwnefaektvlvlyggaqelhefav
    knpfgssktakakkiegsnvtihttsnltvvlqwtassarqvvqlgslviymvdrnsayn
    ywvptlpgsgkqsaygsslmnpdsviinggylirsvaikgnalsvqadfnvttpleiigi
    pkgisklavngkelgysvselgdwiahpaieiphvqvpeltklkwykvdslpeirsnydd
    srwplanlrtsnntyaplktpvslygsdygfhagtllfrgrftartarqqlflstqggsa
    fassvwlndrfigsftgfdaasaanssytldrlvrgrryiltvvvdstgldenwttgdds
    mkaprgildyaltsssganvsiswkltgnlggedyrdvfrgplnegglfferqgfhlpsp
    plsdfthgpsssssssspldgiahagiafyaaklplhlpaqeydiplsfvfdnataaapy
    rallyvngfqygkyvsnigpqtefpvpegildyngdnwigvalwalesrgakvpglalks
    kspiltgrervevvkgphfkkrhgay