PDB entry 3ogn

View 3ogn on RCSB PDB site
Description: Crystal Structure of an Odorant-binding Protein from the Southern House Mosquito Complexed with an Oviposition Pheromone
Class: transport protein
Keywords: helix bundle, Odorant-binding Protein, TRANSPORT PROTEIN
Deposited on 2010-08-17, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.134
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Culex quinquefasciatus [TaxId:7176]
    Gene: CpipJ_CPIJ007604
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ogna_
  • Chain 'B':
    Compound: odorant-binding protein
    Species: Culex quinquefasciatus [TaxId:7176]
    Gene: CpipJ_CPIJ007604
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ognb_
  • Heterogens: 3OG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ognA (A:)
    vtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfhe
    akvvddngdvhleklhdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpkh
    yflv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ognB (B:)
    vtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfhe
    akvvddngdvhleklhdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpkh
    yflv