PDB entry 3ogg

View 3ogg on RCSB PDB site
Description: Crystal structure of the receptor binding domain of botulinum neurotoxin D
Class: toxin
Keywords: Botulinum neurotoxin, serotype D, receptor binding domain, jelly roll trefoil fold, receptor binding, gangliosides, membrane to cytoplasm, TOXIN
Deposited on 2010-08-16, released 2010-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.173
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type D
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botD, Botulinum Neurotoxin D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ogga1, d3ogga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oggA (A:)
    sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni
    lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky
    kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv
    fgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyyii
    ndnyidryiapesnvlvlvqypdrsklytgnpitiksvsdknpysrilngdniilhmlyn
    srkymiirdtdtiyatqggecsqncvyalklqsnlgnygigifsiknivsknkycsqifs
    sfrentmlladiykpwrfsfknaytpvavtnyetkllstssfwkfisrdpgwve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oggA (A:)
    sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni
    lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky
    kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv
    fgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyyii
    ndnyidryiapesnvlvlvqypdrsklytgnpitiksvsdknpysrilngdniilhmlyn
    srkymiirdtdtincvyalklqsnlgnygigifsiknivsknkycsqifssfrentmlla
    diykpwrfsfknaytpvavtnyetkllstssfwkfisrdpgwve