PDB entry 3of8

View 3of8 on RCSB PDB site
Description: Structural Basis for Reversible and Irreversible Inhibition of Human Cathepsin L by their Respective Dipeptidyl Glyoxal and Diazomethylketone Inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-14, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL1, CTSL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3of8a_
  • Heterogens: I0Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3of8A (A:)
    eaprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgp
    qgnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqe
    kalmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdn
    nkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv