PDB entry 3of1

View 3of1 on RCSB PDB site
Description: Crystal Structure of Bcy1, the Yeast Regulatory Subunit of PKA
Class: transferase
Keywords: Cyclic nucleotide binding domain, Evolution, PKA signaling, Regulatory subunit, cAMP-dependent protein kinase, TRANSFERASE
Deposited on 2010-08-13, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase regulatory subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BCY1, REG1, SRA1, YIL033C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3of1a1, d3of1a2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3of1A (A:)
    qlqrleksirnnflfnkldsdskrlvincleeksvpkgatiikqgdqgdyfyvvekgtvd
    fyvndnkvnssgpgssfgelalmynspraatvvatsdcllwaldrltfrkillgssfkkr
    lmyddllksmpvlkslttydrakladaldtkiyqpgetiiregdqgenfylieygavdvs
    kkgqgvinklkdhdyfgevallndlprqatvtatkrtkvatlgksgfqrllgpavdvlkl
    ndptrh