PDB entry 3of0

View 3of0 on RCSB PDB site
Description: crystal structure of the L317I mutant of the chicken c-Src tyrosine kinase domain
Class: transferase
Keywords: c-Src L317I mutant, tyrosine kinase, transferase
Deposited on 2010-08-13, released 2011-08-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered mutation (69)
    Domains in SCOPe 2.03: d3of0a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered mutation (69)
    Domains in SCOPe 2.03: d3of0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3of0A (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkkirheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3of0A (A:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    irheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgillt
    elttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylq
    afledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3of0B (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkkirheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3of0B (B:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktmspeaflqeaqvmkkirhek
    lvqlyavvsyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhr
    dlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgilltelttkgrvp
    ypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyfts
    tepqyqpgenl