PDB entry 3odo

View 3odo on RCSB PDB site
Description: Crystal Structure of the DH/PH Domains of p115-RhoGEF
Class: signaling protein
Keywords: regulation of RhoA GTPase, RhoGEF, DH, PH, Rho, SIGNALING PROTEIN
Deposited on 2010-08-11, released 2011-01-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.223
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92888 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3odoa1, d3odoa2
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92888 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3odob1, d3odob2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3odoA (A:)
    qtsppgwrelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclf
    fpleelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfqki
    ssrfcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkypll
    lqsigqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrldlshlrqss
    dpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllkshs
    rtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserknw
    calitetagslkvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3odoA (A:)
    qtsppgwrelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclf
    fpleelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfqki
    ssrfcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkypll
    lqsigqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrldlshlrqss
    dpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllkshs
    rtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserknw
    calitetags
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3odoB (B:)
    qtsppgwrelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclf
    fpleelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfqki
    ssrfcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkypll
    lqsigqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrldlshlrqss
    dpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllkshs
    rtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserknw
    calitetagslkvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3odoB (B:)
    qtsppgwrelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclf
    fpleelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfqki
    ssrfcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkypll
    lqsigqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrldlshlrqss
    dpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllkshs
    rtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserknw
    calitetags