PDB entry 3od4

View 3od4 on RCSB PDB site
Description: Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: OXIDOREDUCTASE, ASPARAGINYL HYDROXYLASE, DIOXYGENASE, TRANSCRIPTION, METAL-BINDING, HIF, IRON, HYDROXYLATION, OXYGENASE, NUCLEUS, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-08-10, released 2011-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: FIH1, HIF1AN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3od4a_
  • Heterogens: ZN, 8XQ, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3od4A (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3od4A (A:)
    avasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdt
    nlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhe
    fveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnll
    ligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnp
    dyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrie
    yplkahqkvaimrniekmlgealgnpqevgpllntmikgryn