PDB entry 3ob9

View 3ob9 on RCSB PDB site
Description: Structure of the human MSL3 chromo-barrel domain at 2.5 Angstrom resolution
Class: Transcription Regulator
Keywords: chromodomain, chromo-barrel, chromo, methyllysine binding, histone tail, nucleosome recognition, Histone H4K20Me1, nucleus, Transcription Regulator
Deposited on 2010-08-06, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_401190, MSL3, MSL3L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ob9a_
  • Chain 'B':
    Compound: Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_401190, MSL3, MSL3L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ob9b_
  • Chain 'C':
    Compound: Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_401190, MSL3, MSL3L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ob9c_
  • Chain 'D':
    Compound: Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_401190, MSL3, MSL3L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6NHW8 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d3ob9d1, d3ob9d2
  • Chain 'E':
    Compound: Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_401190, MSL3, MSL3L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ob9e_
  • Heterogens: SO4, NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ob9A (A:)
    gplgssasegmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihf
    ngwnrswdrwaaedhvlrdtdenrrlqrklarkavar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ob9A (A:)
    egmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswd
    rwaaedhvlrdtdenrrlqrklarkavar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ob9B (B:)
    gplgssasegmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihf
    ngwnrswdrwaaedhvlrdtdenrrlqrklarkavar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ob9B (B:)
    gmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswdr
    waaedhvlrdtdenrrlqrklarkava
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ob9C (C:)
    gplgssasegmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihf
    ngwnrswdrwaaedhvlrdtdenrrlqrklarkavar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ob9C (C:)
    egmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswd
    rwaaedhvlrdtdenrrlqrklarkava
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ob9D (D:)
    gplgssasegmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihf
    ngwnrswdrwaaedhvlrdtdenrrlqrklarkavar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ob9D (D:)
    gssasegmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngw
    nrswdrwaaedhvlrdtdenrrlqrklarkava
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ob9E (E:)
    gplgssasegmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihf
    ngwnrswdrwaaedhvlrdtdenrrlqrklarkavar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ob9E (E:)
    kfkfhsgekvlcfepdptkarvlydakivdvivgkipeylihfngwnrswdrwaaedhvl
    rdtdenrrlqrklarkava