PDB entry 3oaw

View 3oaw on RCSB PDB site
Description: 4-Methylpteridineones as Orally Active and Selective PI3K/mTOR Dual Inhibitors
Class: transferase/transferase inhibitor
Keywords: Phosphoinositide kinase, transferase-transferase, inhibition, inhibitor complex., TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-08-05, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.21
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oawa1, d3oawa2, d3oawa3, d3oawa4
  • Heterogens: OAW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oawA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oawA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmdfvlrvcgrde
    ylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeslwdcdrkfrvkirgidi
    pvlltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiyc
    vqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnyc
    hpialpraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvk
    wgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvl
    hyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavil
    eaylrgcgtamlhdftqqvqviemlqkvtldikslsssqvisqlkqklenlqnsqlpesf
    rvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdml
    ilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafk
    devlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhi
    dfghilgnyrvpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfs
    mmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl
    g