PDB entry 3oac

View 3oac on RCSB PDB site
Description: Mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands
Class: transferase
Keywords: prenyltransferase, All alpha-helices fold, prenyltransferase and monoterpene biosynthesis, chroloplast, TRANSFERASE
Deposited on 2010-08-05, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.07: d3oaca1, d3oaca2
  • Chain 'B':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.07: d3oacd1, d3oacd2
  • Heterogens: IPE, DST, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oacA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oacA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtkkttypkligvek
    skefadrlnreaqeqllhfhphraaplialanyiayrdn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oacD (D:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn