PDB entry 3o9n

View 3o9n on RCSB PDB site
Description: Crystal Structure of a new form of xylanase-A-amylase inhibitor protein(XAIP-III) at 2.4 A resolution
Class: hydrolase inhibitor
Keywords: xaip-III, tim barrel, inhibitory protein, amylase, xylanase, hydrolase inhibitor
Deposited on 2010-08-04, released 2010-09-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haementhin
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O9N (0-271)
    Domains in SCOPe 2.06: d3o9na_
  • Heterogens: ACT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3o9nA (A:)
gnldiavywgqnfdersleatcdsgnyayviigflntfgggqtpaldisghspsglepqi
khcqsknvkvllsiggpagpysldsrsdandlavylfnnfllppghsennpfgnavldgi
dfhiehggpsqyqllanilssfrlkgtefaltaapqcvypdpnlgtvinsatfdaiwvqf
ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppakvkfhvfpa
akksykfggimlwdsywdtvsqfsnkilgdgv