PDB entry 3o9m

View 3o9m on RCSB PDB site
Description: Co-crystallization studies of full length recombinant BChE with cocaine offers insights into cocaine detoxification
Class: hydrolase
Keywords: Cholinesterase, HYDROLASE
Deposited on 2010-08-04, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o9ma_
  • Chain 'B':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o9mb_
  • Heterogens: BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o9mA (A:)
    eddiiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatk
    yansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqt
    gtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqk
    niaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyear
    nrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdflt
    dmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpg
    vsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyy
    fehrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnp
    netqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvlemtgnideae
    wewkagfhrwnnymmdwknqfndytskkescvgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o9mA (A:)
    iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
    sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
    slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
    afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
    lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
    dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
    fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
    rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
    qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvlemtg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o9mB (B:)
    eddiiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatk
    yansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqt
    gtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqk
    niaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyear
    nrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdflt
    dmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpg
    vsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyy
    fehrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnp
    netqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvlemtgnideae
    wewkagfhrwnnymmdwknqfndytskkescvgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o9mB (B:)
    iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
    sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
    slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
    afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
    lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
    dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
    fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
    rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
    qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvlemtg