PDB entry 3o8j

View 3o8j on RCSB PDB site
Description: Crystal structure of 2-methylcitrate synthase (PrpC) from Salmonella typhimurium
Class: Transferase
Keywords: Short chain fatty acids, propionate metabolism, 2-methylcitric acid cycle, PrpC or 2-MCS, GltA or CS, Citrate synthase, 2-methylcitrate synthase, Transferase
Deposited on 2010-08-03, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8ja_
  • Chain 'B':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jb_
  • Chain 'C':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jc_
  • Chain 'D':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jd_
  • Chain 'E':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8je_
  • Chain 'F':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jf_
  • Chain 'G':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jg_
  • Chain 'H':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jh_
  • Chain 'I':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8ji_
  • Chain 'J':
    Compound: 2-methylcitrate synthase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpC, STM0369
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o8jj_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o8jA (A:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jA (A:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsi
    ddrc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o8jB (B:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jB (B:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsi
    ddrc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o8jC (C:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jC (C:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkpsanytgpedrpfvsiddr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o8jD (D:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jD (D:)
    gntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklkalr
    glpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslssil
    lywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnastf
    tsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrvenke
    vvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwf
    savsynmmgvptemftplfviarvtgwaahiieqrqdnkianytgpedrpfvsiddrc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3o8jE (E:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jE (E:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsi
    ddrc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3o8jF (F:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jF (F:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsi
    ddrc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3o8jG (G:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jG (G:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsi
    ddrc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3o8jH (H:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jH (H:)
    gntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklkalr
    glpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslssil
    lywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnastf
    tsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrvenke
    vvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwf
    savsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsidd
    rc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3o8jI (I:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jI (I:)
    gntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklkalr
    glpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslssil
    lywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnastf
    tsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrvenke
    vvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwf
    savsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsidd
    rc
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3o8jJ (J:)
    mrgshhhhhhgmashmtdttilqnnthvikpkksvalsgvpagntalctvgksgndlhyr
    gydildlaehcefeevahllihgklptrdelnayksklkalrglpanvrtvlealpaash
    pmdvmrtgvsalgctlpekeghtvsgardiadkllaslssillywyhyshngeriqpetd
    ddsigghflhllhgekptqswekamhislvlyaehefnastftsrviagtgsdvysaiig
    aigalrgpkhgganevsleiqqryetpdeaeadirkrvenkevvigfghpvytiadprhq
    vikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwfsavsynmmgvptemftpl
    fviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsiddrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8jJ (J:)
    pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka
    lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss
    illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas
    tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven
    kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld
    wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiisanytgpedrpfvsidd
    rc