PDB entry 3o86

View 3o86 on RCSB PDB site
Description: Crystal structure of AmpC beta-lactamase in complex with a sulfonamide boronic acid inhibitor
Class: hydrolase
Keywords: Contains alpha helices and a beta sandwich / Beta-lactamase-like fold / AMPC beta-Lactamase, class C, Hydrolase, cephalosporinase
Deposited on 2010-08-02, released 2010-11-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampA, ampC, b4150, JW4111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o86a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampA, ampC, b4150, JW4111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o86b_
  • Heterogens: BSF, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o86A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o86A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiialaarpvkaitpptpavra
    swvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o86B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq