PDB entry 3o7z

View 3o7z on RCSB PDB site
Description: Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose
Class: transferase
Keywords: Branching enzyme, maltohexaose, linear polysaccharide, starch biosynthetic pathway, alpha/beta barrel, TRANSFERASE
Deposited on 2010-08-02, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o7za1, d3o7za2, d3o7za3
  • Chain 'B':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o7zb1, d3o7zb2, d3o7zb3
  • Chain 'C':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o7zc1, d3o7zc2, d3o7zc3
  • Chain 'D':
    Compound: 1,4-alpha-glucan-branching enzyme
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o7zd1, d3o7zd2, d3o7zd3
  • Heterogens: GLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o7zA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7zA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyggrenleaieflrnt
    nrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqy
    hhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpg
    kkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfd
    pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
    smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o7zB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7zB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdipnefggren
    leaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldy
    mkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlra
    yygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrh
    hkamheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqp
    gkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o7zC (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7zC (C:)
    hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
    fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkkan
    qfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdgs
    wgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnly
    ehsliynygrrevsnflvgnalywierfgidalrvdavasmiyrdnefggrenleaiefl
    rntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvy
    rqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwa
    fpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamhel
    dfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreil
    ntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o7zD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7zD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdynefggrenlea
    ieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkl
    dpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayyg
    wmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhka
    mheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkw
    reilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae