PDB entry 3o7r

View 3o7r on RCSB PDB site
Description: Crystal structure of Ru(p-cymene)/apo-H49AFr
Class: Metal Binding Protein
Keywords: iron storage protein, light chain apoferritin, artificial metalloprotein, metal binding protein
Deposited on 2010-07-31, released 2011-04-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Gene: FTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02791 (0-End)
      • engineered mutation (48)
      • engineered mutation (92)
    Domains in SCOPe 2.02: d3o7ra_
  • Heterogens: CD, RU, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o7rA (A:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvcaffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o7rA (A:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvcaffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh