PDB entry 3o6o

View 3o6o on RCSB PDB site
Description: Crystal Structure of the N-terminal domain of an HSP90 from Trypanosoma Brucei, Tb10.26.1080 in the presence of an the inhibitor BIIB021
Class: chaperone
Keywords: Trypanosoma, African Sleeping sickness, heat shock protein, Structural Genomics, Structural Genomics Consortium, SGC, CHAPERONE
Deposited on 2010-07-29, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein 83
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.26.1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q389P1 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3o6oa1, d3o6oa2
  • Chain 'B':
    Compound: Heat shock protein 83
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.26.1080
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o6ob_
  • Heterogens: 94M, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o6oA (A:)
    gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
    hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
    gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
    qeyleerrlkdlikkhsefigydielmventtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6oA (A:)
    gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
    hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
    gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
    qeyleerrlkdlikkhsefigydielmve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o6oB (B:)
    gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
    hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
    gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
    qeyleerrlkdlikkhsefigydielmventtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6oB (B:)
    mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
    lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
    vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdlkrgtrivlhlkedqqey
    leerrlkdlikkhsefigydielmv