PDB entry 3o6k

View 3o6k on RCSB PDB site
Description: Crystal structure of anti-Tat HIV Fab'11H6H1
Class: immune system
Keywords: antigen-binding site, U-shaped groove, IMMUNE SYSTEM, Tat HIV
Deposited on 2010-07-29, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 11H6H1 Fab' heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O6K (0-End)
  • Chain 'L':
    Compound: 11H6H1 Fab' light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O6K (0-End)
    Domains in SCOPe 2.07: d3o6kl1, d3o6kl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3o6kL (L:)
    dvvmtqtpltlsvtigqpasiscksgqsllysdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgiyycwqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o6kL (L:)
    dvvmtqtpltlsvtigqpasiscksgqsllysdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgiyycwqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn