PDB entry 3o50

View 3o50 on RCSB PDB site
Description: Crystal structure of benzamide 9 bound to AuroraA
Class: transferase
Keywords: AuroraA, kinase domain, TRANSFERASE
Deposited on 2010-07-27, released 2010-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.285
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cDNA FLJ58295, highly similar to Serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3o50a_
  • Chain 'B':
    Compound: cDNA FLJ58295, highly similar to Serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3o50b_
  • Heterogens: LJE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o50A (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o50A (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwtldylppemiehdekvdlwslgvlcyef
    lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
    itanss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o50B (B:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o50B (B:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfttlcgtldylppemiedekvdlwslgvlcy
    eflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevleh
    pwitanssk