PDB entry 3o0r

View 3o0r on RCSB PDB site
Description: Crystal structure of nitric oxide reductase from Pseudomonas aeruginosa in complex with antibody fragment
Class: immune system/oxidoreductase
Keywords: oxidoreductase, electron transport, heme, iron, membrane, cytoplasmic membrane, IMMUNE SYSTEM-OXIDOREDUCTASE complex
Deposited on 2010-07-20, released 2010-12-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Nitric oxide reductase subunit B
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nitric oxide reductase subunit C
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59646 (Start-145)
      • conflict (99)
  • Chain 'H':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O0R (0-224)
  • Chain 'L':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3O0R (0-212)
    Domains in SCOPe 2.04: d3o0rl1, d3o0rl2
  • Heterogens: HEM, FE, O, CA, HEC, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0rL (L:)
    diqmtqsppylaaspgetitincrasksirkylawyqekpgktnklliysgstlqfgips
    rfsgsgsgteftltisslepedfamyycqqhneypltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne