PDB entry 3o0g

View 3o0g on RCSB PDB site
Description: Crystal Structure of Cdk5:p25 in complex with an ATP analogue
Class: transferase/transferase activator
Keywords: kinase, Kinase activator complex, kinase inhibitor complex, TRANSFERASE-TRANSFERASE ACTIVATOR complex
Deposited on 2010-07-19, released 2011-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.228
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: Cdk5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00535 (0-End)
      • engineered mutation (143)
    Domains in SCOPe 2.03: d3o0ga_
  • Chain 'B':
    Compound: cell division protein kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: Cdk5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00535
      • engineered mutation (143)
    Domains in SCOPe 2.03: d3o0gb_
  • Chain 'D':
    Compound: Cyclin-dependent kinase 5 activator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: p25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o0gd_
  • Chain 'E':
    Compound: Cyclin-dependent kinase 5 activator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: p25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o0ge_
  • Heterogens: 3O0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o0gA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0gA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o0gB (B:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0gB (B:)
    klekigtvfkaeivalkrvrpssalreicllkelkhknivrlhdvlhsdkkltlvfefcd
    qdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqnllinrngelklan
    fglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagcifaelanagrplfp
    gndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnvvpklnatgrdllq
    nllkcnpvqrisaeealqhpyfsd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0gD (D:)
    qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
    ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
    inlmsskmlqinadphyftqvfsdlknes
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0gE (E:)
    qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
    ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
    inlmsskmlqinadphyftqvfsdlknes