PDB entry 3o0d

View 3o0d on RCSB PDB site
Description: Crystal structure of Lip2 lipase from Yarrowia lipolytica at 1.7 A resolution
Class: hydrolase
Keywords: alpha/beta-Hydrolase, lipase, lipids binding, glycosylation, extracellular, HYDROLASE
Deposited on 2010-07-19, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0da_
  • Chain 'B':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0db_
  • Chain 'C':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0dc_
  • Chain 'D':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0dd_
  • Chain 'E':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0de_
  • Chain 'F':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0df_
  • Chain 'G':
    Compound: triacylglycerol lipase
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: lip2, YALI0A20350g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3o0dg_
  • Heterogens: NAG, MPD, MRD, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0dA (A:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0dB (B:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0dC (C:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o0dD (D:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0dD (D:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdiriltnfdlaanisstatcddcl
    vhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvnghdplv
    vtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdgyqhc
    sgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcgi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o0dE (E:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3o0dF (F:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0dF (F:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirapltnfdlaanisstatcddc
    lvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvnghdpl
    vvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdgyqh
    csgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcgi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3o0dG (G:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0dG (G:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc
    ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntlnvignhlqyfvtegvcg