PDB entry 3nzh

View 3nzh on RCSB PDB site
Description: Crystal structure of anti-emmprin antibody 5F6 FAB
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2010-07-16, released 2011-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: 5f6 heavy chain
  Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3NZH
• Chain 'L':
  Compound: 5f6 light chain
  Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3NZH (0-213)
  Domains in SCOPe 2.06: d3nzhl1, d3nzhl2
• Heterogens: GOL, CO, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3nzhL (L:)
  sivmtqtpkfllvsagdrvtitckasqsvsndvawyqqkpgqspklliyyasnrytgvpd
  rftgsgygtdftftistvqaedlavyfcqqdysspytfgggtkleikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec