PDB entry 3nxq

View 3nxq on RCSB PDB site
Description: Angiotensin Converting Enzyme N domain glycsoylation mutant (Ndom389) in complex with RXP407
Class: hydrolase/hydrolase inhibitor
Keywords: dicarboxy zinc metallopeptidase, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-07-14, released 2010-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • engineered mutation (8)
      • engineered mutation (24)
      • engineered mutation (81)
      • engineered mutation (116)
      • engineered mutation (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.04: d3nxqa_
  • Chain 'B':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • engineered mutation (8)
      • engineered mutation (24)
      • engineered mutation (81)
      • engineered mutation (116)
      • engineered mutation (130)
      • engineered mutation (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.04: d3nxqb_
  • Heterogens: ZN, RX4, P6G, CL, PEG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nxqA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxqA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nxqB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxqB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypeg