PDB entry 3nxl

View 3nxl on RCSB PDB site
Description: Crystal structure of Glucarate dehydratase from Burkholderia cepacia complexed with magnesium
Class: lyase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2010-07-14, released 2010-07-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Burkholderia sp. 383 [TaxId:269483]
    Gene: Bcep18194_A3396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nxla1
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Burkholderia sp. 383 [TaxId:269483]
    Gene: Bcep18194_A3396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nxlb1
  • Chain 'C':
    Compound: glucarate dehydratase
    Species: Burkholderia sp. 383 [TaxId:269483]
    Gene: Bcep18194_A3396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nxlc1
  • Chain 'D':
    Compound: glucarate dehydratase
    Species: Burkholderia sp. 383 [TaxId:269483]
    Gene: Bcep18194_A3396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nxld1
  • Heterogens: MG, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nxlA (A:)
    mslsesrrdgtprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevp
    ggegirhalermtdlvvgqsigryqatlnavraalsgagpgagrtirhevtsageaavlr
    qpheinlrldnvitaieaalldllgqhldvpvaallgegqqrdavpmlaylfyigdrgrt
    dlpyrdeaqartpwfrlrneealtpaaiarqaeaavdrygfadfklkggvmagademeai
    aaikacfpdaratldpngawsldeavalcrgqghllayaedpcgpeggysgrevmaefrr
    atgiptatnmiatdwrqmdhavrlqavdipladphfwtmqgsvrlaqlcrdwgltwgshs
    nnhfdvslamfthaaaaapgtitaidthwiwqegdarltreplkivggqvavperpglgi
    eldmaqveaahalykevggtarddavamrylvpgwtydpkrpsfgrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxlA (A:)
    tprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevpggegirhale
    rmtdlvvgqsigryqatlnavraalsrldnvitaieaalldllgqhldvpvaallgegqq
    rdavpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavdrygf
    adfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghllayaed
    pcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfwtmqg
    svrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdarltre
    plkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwtydpkr
    psfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nxlB (B:)
    mslsesrrdgtprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevp
    ggegirhalermtdlvvgqsigryqatlnavraalsgagpgagrtirhevtsageaavlr
    qpheinlrldnvitaieaalldllgqhldvpvaallgegqqrdavpmlaylfyigdrgrt
    dlpyrdeaqartpwfrlrneealtpaaiarqaeaavdrygfadfklkggvmagademeai
    aaikacfpdaratldpngawsldeavalcrgqghllayaedpcgpeggysgrevmaefrr
    atgiptatnmiatdwrqmdhavrlqavdipladphfwtmqgsvrlaqlcrdwgltwgshs
    nnhfdvslamfthaaaaapgtitaidthwiwqegdarltreplkivggqvavperpglgi
    eldmaqveaahalykevggtarddavamrylvpgwtydpkrpsfgrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxlB (B:)
    tprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevpggegirhale
    rmtdlvvgqsigryqatlnavraalrldnvitaieaalldllgqhldvpvaallgegqqr
    davpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavdrygfa
    dfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghllayaedp
    cgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfwtmqgs
    vrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdarltrep
    lkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwtydpkrp
    sfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nxlC (C:)
    mslsesrrdgtprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevp
    ggegirhalermtdlvvgqsigryqatlnavraalsgagpgagrtirhevtsageaavlr
    qpheinlrldnvitaieaalldllgqhldvpvaallgegqqrdavpmlaylfyigdrgrt
    dlpyrdeaqartpwfrlrneealtpaaiarqaeaavdrygfadfklkggvmagademeai
    aaikacfpdaratldpngawsldeavalcrgqghllayaedpcgpeggysgrevmaefrr
    atgiptatnmiatdwrqmdhavrlqavdipladphfwtmqgsvrlaqlcrdwgltwgshs
    nnhfdvslamfthaaaaapgtitaidthwiwqegdarltreplkivggqvavperpglgi
    eldmaqveaahalykevggtarddavamrylvpgwtydpkrpsfgrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxlC (C:)
    gtprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevpggegirhal
    ermtdlvvgqsigryqatlnavraalsrldnvitaieaalldllgqhldvpvaallgegq
    qrdavpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavdryg
    fadfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghllayae
    dpcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfwtmq
    gsvrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdarltr
    eplkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwtydpk
    rpsfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nxlD (D:)
    mslsesrrdgtprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevp
    ggegirhalermtdlvvgqsigryqatlnavraalsgagpgagrtirhevtsageaavlr
    qpheinlrldnvitaieaalldllgqhldvpvaallgegqqrdavpmlaylfyigdrgrt
    dlpyrdeaqartpwfrlrneealtpaaiarqaeaavdrygfadfklkggvmagademeai
    aaikacfpdaratldpngawsldeavalcrgqghllayaedpcgpeggysgrevmaefrr
    atgiptatnmiatdwrqmdhavrlqavdipladphfwtmqgsvrlaqlcrdwgltwgshs
    nnhfdvslamfthaaaaapgtitaidthwiwqegdarltreplkivggqvavperpglgi
    eldmaqveaahalykevggtarddavamrylvpgwtydpkrpsfgrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxlD (D:)
    gtprvtrmqvipvagrdsmllnlcgahapyftrnlvilddssghtgvgevpggegirhal
    ermtdlvvgqsigryqatlnavraalsrldnvitaieaalldllgqhldvpvaallgegq
    qrdavpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavdryg
    fadfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghllayae
    dpcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfwtmq
    gsvrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdarltr
    eplkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwtydpk
    rpsfg