PDB entry 3nul

View 3nul on RCSB PDB site
Description: Profilin I from Arabidopsis thaliana
Deposited on 1996-11-27, released 1997-12-03
The last revision prior to the SCOP 1.71 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1808
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d3nul__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nul_ (-)
    swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
    ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
    lgdyliesel