PDB entry 3npk

View 3npk on RCSB PDB site
Description: The crystal structure of geranyltranstransferase from Campylobacter jejuni
Class: transferase
Keywords: Transferase, isoprene biosynthesis, SGX, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2010-06-28, released 2010-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Campylobacter jejuni [TaxId:195099]
    Gene: CJE1816, ispA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HSE9 (3-282)
      • expression tag (2)
    Domains in SCOPe 2.06: d3npka1, d3npka2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Campylobacter jejuni [TaxId:195099]
    Gene: CJE1816, ispA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HSE9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3npkb1, d3npkb2
  • Heterogens: PPV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3npkA (A:)
    mslnlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpelln
    qaldvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflv
    lshahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarlia
    aalkmgceicelnneesnqiyklglklglifqinddiidvttsqeqsgkptnndihknsf
    vnllgleqaiktkenllneceqdleklneklaqmiqnliiqyleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3npkA (A:)
    lnlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnqa
    ldvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvls
    hahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarliaaa
    lkmgceicelnneesnqiyklglklglifqinddiidvtnsfvnllgleqaiktkenlln
    eceqdleklneklaqmiqnliiqyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3npkB (B:)
    mslnlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpelln
    qaldvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflv
    lshahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarlia
    aalkmgceicelnneesnqiyklglklglifqinddiidvttsqeqsgkptnndihknsf
    vnllgleqaiktkenllneceqdleklneklaqmiqnliiqyleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3npkB (B:)
    slnlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnq
    aldvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvl
    shahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarliaa
    alkmgceicelnneesnqiyklglklglifqinddiidnsfvnllgleqaiktkenllne
    ceqdleklneklaqmiqnlii