PDB entry 3no1

View 3no1 on RCSB PDB site
Description: Crystal Structure of Mandelate racemase/muconate lactonizing enzyme from a Marine actinobacterium in complex with magnesium
Class: isomerase
Keywords: ENOLASE,METAL-BINDING,PSI-II, NYSGXRC, ISOMERASE, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2010-06-24, released 2010-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3no1a1, d3no1a2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3no1b1, d3no1b2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3no1c1, d3no1c2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3no1d1, d3no1d2
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3no1e1, d3no1e2
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium [TaxId:312284]
    Gene: A20C1_08358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3no1f1, d3no1f2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3no1A (A:)
    mslhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtd
    agiigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlg
    lvalaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqel
    glagvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnir
    wfeepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggp
    tawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpkl
    nngtltlsdrpglgwdlnwdyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no1A (A:)
    ltitrietipmvaplahrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
    gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrn
    elpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddf
    iicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqte
    fsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllas
    qphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3no1B (B:)
    mslhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtd
    agiigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlg
    lvalaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqel
    glagvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnir
    wfeepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggp
    tawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpkl
    nngtltlsdrpglgwdlnwdyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no1B (B:)
    ltitrietipmvarativtrvhtdagiigeaytgdehetmfdidriiheelaptligqda
    maierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrnelpm
    iaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfiici
    danqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtefsas
    gcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasqphg
    tiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3no1C (C:)
    mslhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtd
    agiigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlg
    lvalaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqel
    glagvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnir
    wfeepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggp
    tawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpkl
    nngtltlsdrpglgwdlnwdyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no1C (C:)
    gltitrietipmvaplahrativtrvhtdagiigeaytgdehetmfdidriiheelaptl
    igqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyr
    nelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagdd
    fiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqt
    efsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthlla
    sqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3no1D (D:)
    mslhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtd
    agiigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlg
    lvalaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqel
    glagvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnir
    wfeepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggp
    tawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpkl
    nngtltlsdrpglgwdlnwdyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no1D (D:)
    ltitrietipmvarativtrvhtdagiigeaytgdehetmfdidriiheelaptligqda
    maierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrnelpm
    iaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfiici
    danqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtefsas
    gcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasqphg
    tiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3no1E (E:)
    mslhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtd
    agiigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlg
    lvalaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqel
    glagvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnir
    wfeepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggp
    tawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpkl
    nngtltlsdrpglgwdlnwdyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no1E (E:)
    gltitrietipmvarativtrvhtdagiigeaytgdehetmfdidriiheelaptligqd
    amaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrnelp
    miaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfiic
    idanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtefsa
    sgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasqph
    gtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3no1F (F:)
    mslhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtd
    agiigeaytgdehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlg
    lvalaavntaiwdavgkalkmplwklwggyrnelpmiaiggyygeplgsiademhnyqel
    glagvkfkvgglsaaedaaritaareaagddfiicidanqgykpavavdlsrriadlnir
    wfeepvewhndkrsmrdvryqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggp
    tawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpkl
    nngtltlsdrpglgwdlnwdyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no1F (F:)
    gltitrietipmvarativtrvhtdagiigeaytgdehetmfdidriiheelaptligqd
    amaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrnelp
    miaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfiic
    idanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtefsa
    sgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasqph
    gtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidq