PDB entry 3ni8

View 3ni8 on RCSB PDB site
Description: Crystal Structure of PFC0360w, an HSP90 activator from plasmodium falciparum
Class: unknown function
Keywords: heat shock, malaria, ATPase, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2010-06-15, released 2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PFC0360w protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PFC0360w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q689C4 (18-End)
      • expression tag (17)
    Domains in SCOPe 2.04: d3ni8a_
  • Heterogens: IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ni8A (A:)
mhhhhhhssgrenlyfqgmsfeiteeyyvppevlfnaftdaytltrlsrgslaevdlkvg
gkfslfsgsilgefteitkphkivekwkfrdwnecdystvtvefisvkenhtklklthnn
ipasnkyneggvlerckngwtqnflhnievilgypkkk

    Sequence, based on observed residues (ATOM records): (download) 
    >3ni8A (A:)
gmsfeiteeyyvppevlfnaftdaytltrlsrgslaevdlkvggkfslfsgsilgeftei
tkphkivekwkfrdwnecdystvtvefisvkenhtklklthnnipasnkyneggvlerck
ngwtqnflhnievilgypkk