PDB entry 3nf4

View 3nf4 on RCSB PDB site
Description: Crystal structure of acyl-CoA dehydrogenase from Mycobacterium thermoresistibile bound to flavin adenine dinucleotide
Class: oxidoreductase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, FAD, FADH, tuberculosis, acyl-coA, dehydrogenase, OXIDOREDUCTASE
Deposited on 2010-06-09, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NF4
    Domains in SCOPe 2.06: d3nf4a1, d3nf4a2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NF4
    Domains in SCOPe 2.06: d3nf4b1, d3nf4b2
  • Heterogens: FAD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nf4A (A:)
    gpgsmihpmavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaag
    llslpqpeewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrw
    lpgmlsgeqigayslsepqagsdaaalrcaatptdggyvingskswithggkadfytlfa
    rtgegsrgvscflvpadqpglsfgkpeekmglhavpttsafydnaridadrrigeegqgl
    qiafsaldsgrlgiaavatglaqaaldeavayanertafgrkiidhqglgflladmaaav
    ataratyldaarrrdqgrpysqqasiakltatdaamkvttdavqvfggvgytrdyrvery
    mreakimqifegtnqiqrlviargltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nf4A (A:)
    mavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaagllslpqpe
    ewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrwlpgmlsge
    qigayslsepqagsdaaalrcaatptdggyvingskswithggkadfytlfartgsrgvs
    cflvpadqpglsfgkpeekmglhavpttsafydnaridadrrigeegqglqiafsaldsg
    rlgiaavatglaqaaldeavayanekiidhglgflladmaaavataratyldaarrrdqg
    rpysqqasiakltatdaamkvttdavqvfggvgytrdyrverymreakimqifegtnqiq
    rlviarglt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nf4B (B:)
    gpgsmihpmavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaag
    llslpqpeewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrw
    lpgmlsgeqigayslsepqagsdaaalrcaatptdggyvingskswithggkadfytlfa
    rtgegsrgvscflvpadqpglsfgkpeekmglhavpttsafydnaridadrrigeegqgl
    qiafsaldsgrlgiaavatglaqaaldeavayanertafgrkiidhqglgflladmaaav
    ataratyldaarrrdqgrpysqqasiakltatdaamkvttdavqvfggvgytrdyrvery
    mreakimqifegtnqiqrlviargltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nf4B (B:)
    mavdrllpsqeaaelieltreiadkvldpivdrhekdetypegvfeqlgaagllslpqpe
    ewggggqpyevylqvleeiaarwasvavavsvhslsshpllvfgteeqkkrwlpgmlsge
    qigayslseprcaatptdggyvingskswithggkadfytlfartgsrgvscflvpadqp
    glsfgkpeekmglhavpttsafydnaridadrrigeegqglqiafsaldsgrlgiaavat
    glaqaaldeavayanertafgrkiidhqglgflladmaaavataratyldaarrrdqgrp
    ysqqasiakltatdaamkvttdavqvfggvgytrdyrverymreakimqifegtnqiqrl
    viarglt